teduglutide
Sign in to saveAlso known as Gattex Kit, ALX-0600, Teduglutide [rDNA origin], HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, ALX 0600, (Gly2)glp-2, His-gly-asp-gly-ser-phe-ser-asp-glu-met-asn-thr-ile-leu-asp-asn-leu-ala-ala-arg-asp-phe-ile-asn-trp-leu-ile-gln-thr-lys-ile-thr-asp, Teduglutide Recombinant
Teduglutide, sold under the brand names Revestive (EU) and Gattex (US), is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion. It was approved in both the European Union and the United States in 2012.
Key facts
- Drug.Watchedfields
- changed
- Drug.verifiedrevid
- 443663022
- Drug.image
- Teduglutide.svg
- Drug.image_class
- skin-invert-image
- Drug.tradename
- Revestive, Gattex
- Drug.MedlinePlus
- a613019
- Drug.DailyMedID
- Teduglutide
- Drug.routes_of_administration
- Subcutaneous injection
- Drug.ATC_prefix
- A16
- Drug.ATC_suffix
- AX08
- Drug.legal_AU
- S4
- Drug.legal_CA
- Rx-only
- Drug.legal_US
- Rx-only
- Drug.legal_EU
- Rx-only
- Drug.bioavailability
- 88%
- Drug.metabolism
- Proteolysis
- Drug.elimination_half life
- 2h
- Drug.CAS_number
- 197922-42-2
via Wikipedia infobox
Research
372 papers- Teduglutide.2006
- Teduglutide reduces need for parenteral support among patients with short bowel syndrome with intestinal failure.Gastroenterology · 2012
- Teduglutide for pediatric short bowel syndrome patients.Expert review of gastroenterology & hepatology · 2021
- PMID 404937272022
- Teduglutide for short bowel syndrome.Australian prescriber · 2020
via PubMed
Wikidata facts
- Subclass of
- glucagon-like peptide-2
- Mass
- 3750.803
- Has use
- medication
Show 6 more facts
- medical condition treated
- short bowel syndrome
- chemical formula
- C₁₆₄H₂₅₂N₄₄O₅₅S
- World Health Organisation international non-proprietary name
- teduglutide
- defined daily dose
- 5.0
- NCI Thesaurus ID
- C66582
- has characteristic
- biopharmaceutical
Sources (2)
via Wikidata · CC0
~2 min read
Encyclopedic overview
6 sectionsContents
- Medical uses
- Adverse effects
- Chemistry and mechanism of action
- Society and culture
- Legal status
- References
Teduglutide, sold under the brand names Revestive (EU) and Gattex (US), is a 33-membered polypeptide and glucagon-like peptide-2 (GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly restoring gastric emptying and secretion. It was approved in both the European Union and the United States in 2012.
Teduglutide is available as a generic medication.
Excerpted from Wikipedia’s “teduglutide” article, available under the CC BY-SA 4.0 licence.