Skip to content
Vinony
English
EnglishBahasa IndonesiaDeutschEspañolFrançaisPolskiTiếng Việtالعربيةفارسی日本語
EntityQ6659956· pop 14· linked from 147 articles

lixisenatide

Sign in to save

Also known as AVE-0010, H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2, ZP10A peptide, ZP 10, AVE 0010, AQVE-10010, DesPro38Exendin-4(1-39)-Lys6-NH2, AVE0010

Lixisenatide (trade name Lyxumia in the European Union and Adlyxin in the U.S. and manufactured by Sanofi) is a once-daily injectable GLP-1 receptor agonist for the treatment of type 2 diabetes.

Research

732 papers

via PubMed

~8 min read

Encyclopedic overview

7 sections
Contents
  • Medical use
  • Lixisenatide in neurodegenerative diseases
  • Adverse effects
  • Mechanism of action
  • Chemistry
  • History
  • References

Lixisenatide (trade name Lyxumia in the European Union and Adlyxin in the U.S. and manufactured by Sanofi) is a once-daily injectable GLP-1 receptor agonist for the treatment of type 2 diabetes.

==Medical use== Lixisenatide is used as adjunct to diet and exercise to treat type 2 diabetes. In the European Union, its use is limited to complementing insulin therapy. As of 2017 it is unclear if they affect a person's risk of death.

Excerpted from Wikipedia’s “lixisenatide” article, available under the CC BY-SA 4.0 licence.

Available in 14 languages

via Wikidata sitelinks · CC0